PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009798071.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 494aa    MW: 54355.1 Da    PI: 4.7886
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009798071.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS209.41.9e-641533854250
            GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                     +L++cAea+++++l+la+al++ ++ la ++  ++++++ yf   L +++++     ++a    e+s +  ++e   + +f+e+sP+lkf+h+ta
  XP_009798071.1 153 TLMACAEAIQQNNLNLADALVSDIKRLAVQQSGAVKKVVYYFDDTLDRTING-----MNAPYIVESS-Y-CTDE-LLQMYFYETSPYLKFAHFTA 239
                     79**************************************************.....4444444444.2.3333.33457*************** PP

            GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                     NqaIlea++ ++rvH+iDf+++qG QWp L+qaLa R + pp +R+Tg+g      +++  e++  L ++Ae++g++fef+ ++a++l+d++   
  XP_009798071.1 240 NQAILEAFADSNRVHVIDFSLNQGSQWPVLMQALALRHGAPPAFRLTGIGL----PQHSFLEVRYMLVQLAEKIGLEFEFRGFLANSLTDVDAMI 330
                     ***************************************************....779999*******************************999 PP

            GRAS 194 Lrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhns 250
                     L++++   Ea+aVn++++ h+ +++++++e+    +L+++k+++Pk+v+ + +   +ns
  XP_009798071.1 331 LSIRSsnVEAVAVNSIFEPHHAMSRPGAIEK----LLNTIKEMQPKIVTTIIKQEATNS 385
                     99888779***************99999999....*************98766555554 PP

2GRAS76.16.6e-24392487280374
            GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                     + ++ + +++ gr+i n+v+c+g++r+erh tl++Wr +++++GF++v+l++++ +qa+ ll+ ++  +g  vee++g l+l   ++pL+++SaW
  XP_009798071.1 392 SRDSEMAEQYPGRQIHNAVTCKGSDRIERHDTLSQWRVKMNSVGFNSVRLNSNTCNQASKLLSLFHnRHGCGVEENDGFLMLSRDSQPLIATSAW 486
                     5556677777********************************************************999************************** PP

            GRAS 374 r 374
                     +
  XP_009798071.1 487 Q 487
                     6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.54124466IPR005202Transcription factor GRAS
PfamPF035146.7E-62153385IPR005202Transcription factor GRAS
PfamPF035142.3E-21392487IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MSYRSEMSMD TTTEDGESFI SNTDAIINGT SDISALAESL ISGPNIPNSS WTSADDVQQQ  60
ISTAGGGGAA AADDMMIVSS GASSMLSNTN KQSEIMIFNV DFRAVAVCNN SDKIEEKGSA  120
ESSKRLECRF GLGSNIGGAV NEETSFRFVN IYTLMACAEA IQQNNLNLAD ALVSDIKRLA  180
VQQSGAVKKV VYYFDDTLDR TINGMNAPYI VESSYCTDEL LQMYFYETSP YLKFAHFTAN  240
QAILEAFADS NRVHVIDFSL NQGSQWPVLM QALALRHGAP PAFRLTGIGL PQHSFLEVRY  300
MLVQLAEKIG LEFEFRGFLA NSLTDVDAMI LSIRSSNVEA VAVNSIFEPH HAMSRPGAIE  360
KLLNTIKEMQ PKIVTTIIKQ EATNSEWTQS YSRDSEMAEQ YPGRQIHNAV TCKGSDRIER  420
HDTLSQWRVK MNSVGFNSVR LNSNTCNQAS KLLSLFHNRH GCGVEENDGF LMLSRDSQPL  480
IATSAWQLTP PTLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-351514875375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009798071.10.0PREDICTED: DELLA protein GAI-like
RefseqXP_016438186.10.0PREDICTED: DELLA protein GAI-like
SwissprotQ7Y1B61e-136GAI_SOLLC; DELLA protein GAI
TrEMBLK4D4701e-156K4D470_SOLLC; Uncharacterized protein
STRINGSolyc10g086380.1.11e-156(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA128641119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.11e-122GRAS family protein